PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P11050_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 397aa    MW: 44493.3 Da    PI: 5.4503
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P11050_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS93.43.5e-291352401109
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++ L++cA+av+++dl ++++l+++l++++s +g+p+qRl ay++e+L arla+s+s++ykal+++e     ss+ l+++++++ev+
  GSMUA_Achr4P11050_001 135 LKQFLIACARAVAENDLIAVEWLISELRQMVSVSGEPIQRLGAYLLEGLIARLASSGSSIYKALKCKEPV---SSDLLSYMHILYEVC 219
                            5789*****************************************************************8...9************** PP

                   GRAS  89 PilkfshltaNqaIleavege 109
                            P++kf++l aN aI+eav+ e
  GSMUA_Achr4P11050_001 220 PYFKFGYLSANGAIVEAVKDE 240
                            ******************986 PP

2GRAS1962.4e-60238397214374
                   GRAS 214 ldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvace 301
                             desvs++++rd++L+++ks+sPkvv++ve+ea++n+++F+ rfle+l+yy+a+fds+++ lpre++eri+vE+++l+r+ivn++ace
  GSMUA_Achr4P11050_001 238 KDESVSTRNHRDRLLRMIKSVSPKVVTLVEHEANTNTAPFFPRFLETLDYYTAIFDSIDVCLPRENKERISVEQHCLARDIVNIIACE 325
                            5899************************************************************************************ PP

                   GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            gaer+er e ++kW++r+++aGF+p++ls  +++++k+ll++++ + yr+ee++g l+lgWk+rpLv+ +aWr
  GSMUA_Achr4P11050_001 326 GAERVERYELFGKWNSRFTMAGFRPYHLSPLVNATIKTLLQNYS-EHYRLEERDGILYLGWKNRPLVVSCAWR 397
                            ********************************************.55*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098523.3261378IPR005202Transcription factor GRAS
PfamPF035148.4E-58238397IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MPQNHQSSDY VSSDDGFQQR HVQPQTSHVP FCTLESSLAT ANCTTHNPPS SLSFSPISGS  60
SMSQQDSVSD NANGSPVSAT IEDPSDLKNR LREIEAAMLG PDLDTIGNSD NGYPGDLSLE  120
PEKWRGVMET PRGDLKQFLI ACARAVAEND LIAVEWLISE LRQMVSVSGE PIQRLGAYLL  180
EGLIARLASS GSSIYKALKC KEPVSSDLLS YMHILYEVCP YFKFGYLSAN GAIVEAVKDE  240
SVSTRNHRDR LLRMIKSVSP KVVTLVEHEA NTNTAPFFPR FLETLDYYTA IFDSIDVCLP  300
RENKERISVE QHCLARDIVN IIACEGAERV ERYELFGKWN SRFTMAGFRP YHLSPLVNAT  360
IKTLLQNYSE HYRLEERDGI LYLGWKNRPL VVSCAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-24250397224375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396053.11e-170PREDICTED: chitin-inducible gibberellin-responsive protein 2-like
RefseqXP_009396052.11e-170PREDICTED: chitin-inducible gibberellin-responsive protein 2-like
SwissprotQ9LDL73e-87PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLM0SMX00.0M0SMX0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P11050_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.24e-88GRAS family protein